PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00923.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 462aa    MW: 52195.6 Da    PI: 7.0971
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00923.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.3e-155197148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WTteEde l +av+++  ++Wk++a+ +  ++++ qc +rwqk+l
  Rsa1.0_00923.1_g00018.1 51 KGGWTTEEDETLREAVHRFKAKSWKKVAEFFT-HKSEVQCMHRWQKVL 97
                             688****************************9.************986 PP

2Myb_DNA-binding56.94.7e-18103149148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT++Ede +v++vk++G+  W+ I+  ++ gR +kqc++rw+++l
  Rsa1.0_00923.1_g00018.1 103 KGPWTQQEDETIVELVKRYGPAKWAMISDSLP-GRIGKQCRERWYNHL 149
                              79******************************.*************97 PP

3Myb_DNA-binding51.13.2e-16155198146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              + +WT eE++ l++a+  +G++ W+ Ia+ ++ gRt++++k++w++
  Rsa1.0_00923.1_g00018.1 155 KEAWTIEEELVLLKAHLTYGNK-WAEIAKVLP-GRTDNSIKNHWNS 198
                              579*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1724697IPR017930Myb domain
SuperFamilySSF466893.52E-1748111IPR009057Homeodomain-like
SMARTSM007173.4E-135099IPR001005SANT/Myb domain
PfamPF002492.4E-145197IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.1E-2153113IPR009057Homeodomain-like
CDDcd001673.52E-115497No hitNo description
PROSITE profilePS5129429.31298153IPR017930Myb domain
SuperFamilySSF466891.5E-30100196IPR009057Homeodomain-like
SMARTSM007171.8E-16102151IPR001005SANT/Myb domain
PfamPF002493.1E-16103149IPR001005SANT/Myb domain
CDDcd001671.71E-13105149No hitNo description
Gene3DG3DSA:1.10.10.602.2E-24114157IPR009057Homeodomain-like
SMARTSM007171.3E-14154202IPR001005SANT/Myb domain
PROSITE profilePS5129421.164154204IPR017930Myb domain
PfamPF002491.3E-14155198IPR001005SANT/Myb domain
CDDcd001671.21E-10157200No hitNo description
Gene3DG3DSA:1.10.10.603.2E-22158203IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MEDECIEDKQ STPSVSEGSS SSLLKSPGAV PSPATVSPTH RRTSGPVRRT KGGWTTEEDE  60
TLREAVHRFK AKSWKKVAEF FTHKSEVQCM HRWQKVLDPN LTKGPWTQQE DETIVELVKR  120
YGPAKWAMIS DSLPGRIGKQ CRERWYNHLN PGINKEAWTI EEELVLLKAH LTYGNKWAEI  180
AKVLPGRTDN SIKNHWNSSL KKKSEFLLAN NGSLPPPTAA AKNGVLIHKR DSDSVAQTSL  240
VTTQIINKPD EQGDDSCVPL QEVVAAASPM YPPSSPQLPK PENGFHLYYK PQREQHYMAS  300
EADKQRMYGY EYGCSPSTPP VIFITPPPPP PPPPFRKECN NGSGPTSLES FLREAARTFP  360
NMPSIIRKRP RKVVVVVQDH NKTDEEEEEA AKEVVDEKVS PEEEEEKQNN GSKAYYISPP  420
YRIGSKRRAA FKSRQLEFMS PEEEKADDYD DETKSSEKDK LL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-62542039158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-62542039158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013679676.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A078F0G30.0A0A078F0G3_BRANA; BnaC03g35980D protein
STRINGBra001311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16672887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.11e-162myb domain protein 3r-3